IL-17A Monoclonal antibody proteintech 66148-1-Ig
$449.00
In stock
SKU
66148-1-Ig
IL 17, IL17, IL-17, IL17A, 1B3D5
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 155 aa, 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC067505 |
| Conjugate: Unconjugated | Gene Symbol: IL-17A |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3605 |
| Application: Western Blot (WB) | RRID: ENSG00000112115 |
| Dilution: WB : 1:500-1:2000 | Conjugate: AB_2881544 |
| Tested Reactivity: Human, Mouse | Form: Unconjugated |
| Host / Isotype: Mouse / IgG1 | Background Information: IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
