human IBA1 Monoclonal antibody proteintech 66827-1-Ig
$449.00
In stock
SKU
66827-1-Ig
AIF1, IBA1, 1C6A10, AIF 1, AIF-1
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag28236 Product name: Recombinant human IBA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: IBA1 |
| Conjugate: Unconjugated | Gene Symbol: 199 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): ENSG00000204472 |
| Application: Immunohistochemistry (IHC) | RRID: AB_2882170 |
| Dilution: IHC : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
