SRD5A1 Monoclonal antibody proteintech 66329-1-Ig
$449.00
In stock
SKU
66329-1-Ig
1D5D8, 3-oxo-5-alpha-steroid 4-dehydrogenase 1, EC:1.3.1.22, S5AR 1, SR type 1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag23351 Product name: Recombinant human SRD5A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-163 aa of BC007033 Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 32 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: SRD5A1 |
| Conjugate: Unconjugated | Gene Symbol: 6715 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2881710 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein G purification |
| Host / Isotype: Mouse / IgG1 | Background Information: Steroid 5-alpha-reductase (SRD5A1)? ?is a minor component of the reductase activity in prostate although the gene was originally cloned from prostate. On the other hand,?SRD5A1?appears to be the predominant isozyme of steroid 5-alpha-reductase in the scalp and elsewhere in the skin. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
