NeuN Monoclonal antibody proteintech 66836-1-Ig
$449.00
In stock
SKU
66836-1-Ig
3A4C1, Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag28016 Product name: Recombinant human NeuN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Applications: IHC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: NM_001082575 |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: 146713 |
| Conjugate: Unconjugated | Gene Symbol: AB_2882179 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): Unconjugated |
| Application: Immunohistochemistry (IHC) | RRID: Liquid |
| Dilution: IHC : 1:2500-1:10000 | Conjugate: Protein A purification |
| Tested Reactivity: Human, Mouse, Rat | Form: A6NFN3 |
| Host / Isotype: Mouse / IgG1 | Background Information: NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
