Caspase 3/P17/P19 Monoclonal antibody proteintech 66470-2-Ig
$449.00
In stock
SKU
66470-2-Ig
CASP3, Caspase3, 2G4B2, CASP 3, CASP-3
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse And More (5) | Immunogen: CatNo: Ag25029 Product name: Recombinant human CASP3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-176 aa of BC016926 Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 277 aa, 32 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC016926 |
| Conjugate: Unconjugated | Gene Symbol: Caspase 3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 836 |
| Application: Western Blot (WB) | RRID: AB_2876892 |
| Dilution: WB : 1:1000-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Caspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
