PAK1 Polyclonal antibody proteintech 21401-1-AP
$449.00
In stock
SKU
21401-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag16102 Product name: Recombinant human PAK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-65 aa of BC109299 Sequence: APPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTN Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 553 aa, 62 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC109299 |
| Conjugate: Unconjugated | Gene Symbol: PAK1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5058 |
| Application: Western Blot (WB) | RRID: AB_11232232 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The p21-Activated kinase 1 (PAK1), a member of serine-threonine kinases family, was initially identified as an interactor of the Rho GTPases RAC1 and CDC42, which affect a wide range of processes associated with cell motility, survival, metabolism, cell cycle, proliferation, transformation, stress, inflammation, and gene expression(PMID: 32863957). PAK1 is over-expressed in various malignancies such as ovarian, breast, lung, and bladder cancers, and is closely associated with tumor invasion. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
