MUC2 Polyclonal antibody proteintech 27675-1-AP
$449.00
In stock
SKU
27675-1-AP
MUC 2, MUC-2, Mucin 2, SMUC
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (4) | Immunogen: CatNo: Ag25800 Product name: Recombinant human MUC2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 726-850 aa of M94132 Sequence: MYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWV Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 540 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: MUC2 |
| Conjugate: Unconjugated | Gene Symbol: 4583 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2880943 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:1000-1:4000 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse, Rat | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis. |
Reviews
Write Your Own Review