FABP3 Polyclonal antibody proteintech 10676-1-AP
$449.00
In stock
SKU
10676-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag1069 Product name: Recombinant human FABP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007021 |
| Conjugate: Unconjugated | Gene Symbol: FABP3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2170 |
| Application: Western Blot (WB) | RRID: AB_2102309 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: FABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
