Stathmin 1 Polyclonal antibody proteintech 11157-1-AP
$449.00
In stock
SKU
11157-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag1633 Product name: Recombinant human STMN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC014353 Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC014353 |
| Conjugate: Unconjugated | Gene Symbol: Stathmin 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3925 |
| Application: Western Blot (WB) | RRID: AB_2197114 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Stathmin 1 (STMN1) normally regulates microtubule dynamics either by sequestering free tubulin heterodimers or by promoting microtubule catastrophe. STMN1 is highly expressed in fetal and adult brain, spinal cord, and cerebellum. Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. Phosphorylation of stathmin is involved in response to NGF, neuron polarization and microtubule polymerization inhibition activity. Increased expression of STMN1 has been observed in a variety of human malignancies, such as colorectal primary tumors and metastatic tissues, but its association with melanoma is so far not well known. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
