HGF Polyclonal antibody proteintech 26881-1-AP
$449.00
In stock
SKU
26881-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag25456 Product name: Recombinant human HGF protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 118-157 aa of BC130286 Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, ELISA | Observed Molecular Weight: 69 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: HGF |
| Conjugate: Unconjugated | Gene Symbol: 3082 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2880668 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: Hepatocyte growth factor (HGF) is the most potent mitogen of mature hepatocytes in primary culture. HGF is derived from a biologically inactive single chain precursor of 728 amino acids (pro-HGF) localized mostly on the cell surface and in the extracellular matrix. The mature form produced following proteolytic cleavage is composed of a 69-kDa α-subunit (containing four kringle domains) and the 34 kDa β-subunit, similar to the catalytic domain of serine proteases, but with amino acid substitutions in the active site. HGF is a pleiotropic cytokine which exerts a variety of effects on several cells, being involved in the regulation of many biological processes, such as inflammation, tissue repair, morphogenesis, angiogenesis, tumour propagation, immunomodulation of viral infections and cardio-metabolic activities. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
