cGAS Polyclonal antibody proteintech 29958-1-AP
$449.00
In stock
SKU
29958-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag31677 Product name: Recombinant mouse cGAS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 350-507 aa of BC145651 Sequence: KNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 58 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC145651 |
| Conjugate: Unconjugated | Gene Symbol: cGAS |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 214763 |
| Application: Western Blot (WB) | RRID: AB_2935491 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: cGAS (cyclic GMP-AMP synthase) is a cytosolic DNA sensor that serves to mount an immune response against the invasion of microbial pathogens such as viruses. cGAS normally resides as an inactive protein in the cell. Upon binding to DNA, cGAS undergoes a conformational change to an active state and produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP, which is subsequently detected by the cyclic-dinucleotide sensor STING, an ~40 kDa dimeric transmembrane protein at the endoplasmic reticulum (ER). cGAS not only is found in the cytosol but has a multifaceted cellular distribution that involves localization at the cell membrane and in the nucleus (PMID: 32424334). The calculated molecular weight of cGAS is 58 kDa. With post-translational modification, the MW of cGAS will be migrated to 70 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
