VAMP2 Polyclonal antibody proteintech 10135-1-AP
$449.00
In stock
SKU
10135-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag0179 Product name: Recombinant human VAMP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC002737 Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Predict reactive species |
| Applications: WB, IHC, IF, ELISA, Blocking | Observed Molecular Weight: 13 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002737 |
| Conjugate: Unconjugated | Gene Symbol: VAMP2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6844 |
| Application: Western Blot (WB) | RRID: AB_2256918 |
| Dilution: WB : 1:1000-1:5000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: VAMP2 (vesicle-associated membrane protein 2), also named as synaptobrevin 2, is a member of the SNARE (soluble NSF-attachment protein receptor) family proteins. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP2, with a molecular mass of 15-19 kDa, consists of a short N-terminal sequence, a SNARE motif, and a C-terminal transmembrane region. It is required for fast calcium-triggered synaptic vesicle fusion. VAMP2 forms a stable complex with STX1 (syntaxin 1) and SNAP25 (synaptosomal-associated protein 25) during synaptic vesicle fusion (PMID: 16793874). It also forms a distinct complex with synaptophysin. VAMP2 is expressed in nervous system and some non-neuronal tissues, such as skeletal muscle (PMID: 18570252). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
