EAAT2 Polyclonal antibody proteintech 22515-1-AP
$449.00
In stock
SKU
22515-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag18247 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 574 aa, 62 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC132768 |
| Conjugate: Unconjugated | Gene Symbol: EAAT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6506 |
| Application: Western Blot (WB) | RRID: AB_2879112 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: EAAT2 (also known as GLT-1), is encoded by SLC1A2 and is a glutamate transporter which can clear the majority of extracellular glutamate in brain and prevent brain seizures.Three isoforms of EAAT2 exist due to the alternative splicing. In addition to the 65-70 kDa monomer form, 130-150 kDa dimer of EAAT2 can also be observed on SDS-PAGE. (PMID: 22114258) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
