IGF1 Polyclonal antibody proteintech 28530-1-AP
$449.00
In stock
SKU
28530-1-AP
IBP1, IGF I, IGF1, IGF1A, IGF1B, IGFI, Insulin like growth factor I, Mechano growth factor, MGF, Somatomedin C
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (3) | Immunogen: CatNo: Ag29197 Product name: Recombinant human IGF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 49-118 aa of NM_001111285.2 Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKS Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: IGF1 |
| Conjugate: Unconjugated | Gene Symbol: 3479 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2881164 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:50-1:500 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: IGF1, also named as IBP1, MGF, IGF-IA, and Somatomedin-C, belongs to the INS family. IGF1 is structurally and functionally related to INS but has a much higher growth-promoting activity. Altered expression or mutation of IGF-1 is associated with several human disorders, including type I diabetes and various forms of cancer. Defects in IGF1 are the cause of INS-like growth factor I deficiency (IGF1 deficiency) which is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness, and mental retardation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
