GLP1R Polyclonal antibody proteintech 26196-1-AP
$449.00
In stock
SKU
26196-1-AP
GLP 1 R, GLP 1 receptor, GLP 1R, GLP-1 receptor, GLP-1R
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag23529 Product name: Recombinant human GLP1R protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 26-145 aa of BC112126 Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 463 aa, 53 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC112126 |
| Conjugate: Unconjugated | Gene Symbol: GLP1R |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2740 |
| Application: Western Blot (WB) | RRID: AB_2880421 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: GLP1R (glucagon-like peptide-1 receptor) is a G protein-coupled receptor belonging to the secretin receptor super-family, also known as class B (PMID:34911028). GLP1R is widely distributed in pancreatic islets, muscles, gastrointestinal tract, lung, liver, pancreas, and other tissues or organs (PMID:35989517). Moreover, GLP1R agonist has been reported to induce autophagy of EC (Endometrial carcinoma) cells, and high GLP1R expression may be associated with good prognosis of EC patients, suggesting that GLP1R is likely to participate in the progression of EC (PMID:29907137). Natural GLP-1R is known to be N-glycosylated at positions 63, 82 and 115kDa(PMID: 36769142). Moreover, regarding the molecular weight of GLP1R, research shows that the bands at ~50 kDa and ~100 kDa belong to the monomer and dimer states of GLP1R (PMID: 28609478). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
