FABP1 Polyclonal antibody proteintech 13626-1-AP
$449.00
In stock
SKU
13626-1-AP
liver FABP, FABPL, Fatty acid binding protein 1, Fatty acid-binding protein 1, Fatty acid-binding protein, liver
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag4540 Product name: Recombinant human FABP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC032801 Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 127 aa, 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032801 |
| Conjugate: Unconjugated | Gene Symbol: FABP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2168 |
| Application: Western Blot (WB) | RRID: AB_2102017 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: FABP1, liver fatty acid-binding protein, is abundant in cytoplasm that regulates lipid transport and metabolism. It plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PMID:25732850). FABP1 is mainly expressed in hepatocytes, enterocytes and to a lesser degree in renal tubular cells, associated with liver injury (PMID: 15653098). Levels of FABP1 have been found to be elevated in patients with hepatocyte injury secondary to alcohol or drug toxicity (PMID: 14563446). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
