CISD2 Polyclonal antibody proteintech 13318-1-AP
$449.00
In stock
SKU
13318-1-AP
CDGSH iron sulfur domain 2, CDGSH iron-sulfur domain-containing protein 2, CDGSH2, ERIS, Miner1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag4172 Product name: Recombinant human CISD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 61-135 aa of BC032300 Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA | Observed Molecular Weight: 135 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032300 |
| Conjugate: Unconjugated | Gene Symbol: CISD2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 493856 |
| Application: Western Blot (WB) | RRID: AB_2080270 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CISD2 gene encodes a 15 kDa CDGSH iron-sulfur domain-containing protein 2, which is also named Miner1 or NAF-1, this protein was reported on the endoplasmic reticulum membrane or mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2), a rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. CISD2 regulates the autophagy program by interacting with BCL2, contributing to antagonizing BECN1-mediated cellular autophagy at the endoplasmic reticulum. |
Reviews
Write Your Own Review