CXCR2 Polyclonal antibody proteintech 20634-1-AP
$449.00
In stock
SKU
20634-1-AP
IL8RB, CD182, CDw128b, CMKAR2, C-X-C chemokine receptor type 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag14670 Product name: Recombinant human IL-8RB/CXCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC037961 Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL Predict reactive species |
| Applications: WB, IHC, IF-P, IP, CoIP, ELISA | Observed Molecular Weight: 360 aa, 41 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC037961 |
| Conjugate: Unconjugated | Gene Symbol: IL8RB |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3579 |
| Application: Western Blot (WB) | RRID: AB_10693624 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
