APP/Beta Amyloid Polyclonal antibody proteintech 25524-1-AP
$449.00
In stock
SKU
25524-1-AP
amyloid precursor protein, APP, A4 amyloid protein, AB40, AB42
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag22408 Product name: Recombinant human APP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 653-751 aa of BC065529 Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 100 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: APP |
| Conjugate: Unconjugated | Gene Symbol: 351 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2880118 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse, Rat | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: Aβ derives from APP via proteolytic cleavage by proteases called α-, β- and γ-secretase. The α-secretase cleavage precludes the formation of Aβ, while the β- and γ-cleavages generate APP components with amyloidogenic features. Amyloid beta A4 precursor protein(APP), encoded by APP gene which locate on human chromosome 21q, is a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. APP expressed in all fetal tissues and is pronounced in brain, kidney, heart and spleen, but weak in liver. Defects in APP are the cause of Alzheimer disease type 1 (AD1). Amyloid β (Aβ) precursor protein (APP) is a 100-140 kDa transmembrane glycoprotein that exists as several isoforms. This antibody can recognize several isoforms of both mature and immature amyloid beta (A4) precursor protein, including APP770, APP677, APP695, APP696, APP733, APP751, APP752, and APP639. APP can be cleaved into several chains, this antibody could recognize fragments C99, Amyloid-beta protein 42, Amyloid-beta protein 40, C83, P3(40), C80, Gamma-secretase C-terminal fragment 59, Gamma-secretase C-terminal fragment 57, Gamma-secretase C-terminal fragment 50, C31. |
Reviews
Write Your Own Review