MCU/CCDC109A Polyclonal antibody proteintech 26312-1-AP
$449.00
In stock
SKU
26312-1-AP
C10orf42, Calcium uniporter protein, CCDC109A, MCU, MCU/CCDC109A
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 35 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC034235 |
| Conjugate: Unconjugated | Gene Symbol: CCDC109A |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 90550 |
| Application: Western Blot (WB) | RRID: AB_2880474 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
