Anti-Human CD302 Rabbit Recombinant Antibody Proteintech 98413-1-RR
$299.00
In stock
SKU
98413-1-RR
BIMLEC, C type lectin BIMLEC, CD302 antigen, CD302 molecule, CLEC13A
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2671 Product name: Recombinant Human CD302 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 23-168 aa of NM_014880.5 Sequence: DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：9936 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q8IX05-1 | Formulation:：PBS, Azide6 |
| Formulation:：PBS, Azide7 | |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
