ZG16 Monoclonal antibody proteintech 67389-1-Ig
$449.00
In stock
SKU
67389-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag11332 Product name: Recombinant human ZG16 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-167 aa of BC029149 Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, ELISA | Observed Molecular Weight: 167 aa, 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC029149 |
| Conjugate: Unconjugated | Gene Symbol: ZG16 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 653808 |
| Application: Western Blot (WB) | RRID: AB_2882633 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Zymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
