Anti-Human ADAM17 Rabbit Recombinant Antibody Proteintech 98674-2-RR
$299.00
In stock
SKU
98674-2-RR
ADAM 17, cSVP, Disintegrin and metalloproteinase domain-containing protein 17, EC:3.4.24.86, Snake venom-like protease
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg4732 Product name: Recombinant Human ADAM17 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 470-570 aa of NM_003183.5 Sequence: FQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTVCLDL Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：6868 | Formulation:：PBS, Azide5 |
| Storage Buffer：P78536-1 | Formulation:：PBS, Azide6 |
| Background Information：The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 mediates the release of pro-inflammatory cytokines and modulates cell signaling pathways involved in tumor progression and metastasis (PMID:17438092). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
