Anti-Mouse CXCR4/CD184 Rabbit Recombinant Antibody Proteintech 98233-1-RR
$299.00
In stock
SKU
98233-1-RR
241956H2, CD184, Cmkar4, C-X-C chemokine receptor type 4, Cxcr4
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2231 Product name: Recombinant Mouse CXCR4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-40 aa of NM_009911.3 Sequence: MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNR Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：12767 | Formulation:：PBS, Azide5 |
| Storage Buffer：P70658 | Formulation:：PBS, Azide6 |
| Background Information：C-X-C chemokine receptor type 4 (CXCR4, also known as CD184) is a widely expressed G protein-coupled seven-transmembrane receptor. CXCL12/SDF-1 is the biological ligand for CXCR4. The binding of CXCL12 to CXCR4 induces intracellular signaling through several divergent pathways initiating signals related to chemotaxis, cell survival and/or proliferation, increase in intracellular calcium, and gene transcription (PMID: 20484021). CXCR4 also functions as a coreceptor for HIV-1 entry (PMID: 9427609). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
