FcZero-rAb? Biotin Anti-Mouse TNFRSF9/CD137 Rabbit Recombinant Antibody Proteintech Biotin-FcA98182
$299.00
In stock
SKU
Biotin-FcA98182
241647E11, 4-1BB, 4-1BB ligand receptor, CD137, Ila
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg1627 Product name: Recombinant Mouse TNFRSF9/CD137 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-187 aa of NM_001077509.1 Sequence: VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL Predict reactive species | Formulation::PBS, Azide4 |
| RRID:21942 | Formulation::PBS, Azide5 |
| Storage Buffer:Protein A purification | Formulation::PBS, Azide6 |
| Background Information:CD137, also known as TNFRSF9 or 4-1BB, is an inducible T cell surface receptor that belongs to the tumor necrosis factor receptor superfamily. CD137 is a transmembrane protein expressed on the surface of activated T-cells. In addition, activation-dependent expression of CD137 has also been found in B lymphocytes, monocytes, and diverse nonlymphoid cell types. CD137 provides a co-stimulatory signal that enhances the survival, and differentiation of cells, and has a crucial role in the development of CD8 cytotoxic T cells and anti-tumor immunity. (PMID: 9826581; 23696891) | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC)0 |