Anti-Mouse CD302 Rabbit Recombinant Antibody Proteintech 98434-2-RR
$299.00
In stock
SKU
98434-2-RR
CD302 antigen, Clec13a, C-type lectin domain family 13 member A, Type I transmembrane C-type lectin receptor DCL-1
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2660 Product name: Recombinant Mouse CD302 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 21-156 aa of NM_025422.4 Sequence: DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：66205 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q9DCG2-2 | Formulation:：PBS, Azide6 |
| Background Information：CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis. In mice and humans, CD302 is primarily expressed in the liver, lungs, lymph nodes (LNs), spleen, and bone marrow. In CD302 gene knockout (CD302KO) mice, the migration frequency and number of myeloid dendritic cells (mDC) in CD302KO lymph nodes were reduced compared to the wild type, confirming the functional role of CD302 in mDC migration. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
