FcZero-rAb? APC Anti-Human CD300e Rabbit Recombinant Antibody Proteintech APC-FcA98235
$299.00
In stock
SKU
APC-FcA98235
CD300LE, CLM 2, CLM2, CMRF35 A5, CMRF35A5
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Eg2638 Product name: recombinant human CD300E protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 19-131 aa of NM_181449.2 Sequence: KGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAI Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：342510 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：CD300e, also known as immune receptor expressed on myeloid cells 2 (IREM-2), CLM-2, or CMRF35-A5, is one of the CD300 family members which belong to the immunoglobulin (Ig) superfamily (PMID: 15557162; 20039296). CD300e is a type I transmembrane glycoprotein that contains an extracellular region comprising an Ig-like domain, a transmembrane region, and a short cytoplasmic tail (PMID: 15557162; 29358324). It is by monocytes and myeloid dendritic cells and transmits an immune-activating signal by interacting with DNAX-activating protein 12 (DAP12) (PMID: 29358324). | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
