FcZero-rAb? APC Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody Proteintech APC-FcA98226
$299.00
In stock
SKU
APC-FcA98226
C5AR, C5AR1, C5A, C5a anaphylatoxin chemotactic receptor 1, C5a R
| Formulation:：PBS, Azide, BSA | Formulation:：PBS, Azide, BSA1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide, BSA2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, BSA3 |
| Type：CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species | Formulation:：PBS, Azide, BSA4 |
| RRID：728 | Formulation:：PBS, Azide, BSA5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide, BSA6 |
| Background Information：C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. | Formulation:：PBS, Azide, BSA7 |
| biogegep8 | Formulation:：PBS, Azide, BSA8 |
| biogegep9 | Formulation:：PBS, Azide, BSA9 |
| Formulation:：PBS, Azide, BSA0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
