Anti-Mouse IL-23 p19 Rabbit Recombinant Antibody Proteintech 98392-1-RR
$299.00
In stock
SKU
98392-1-RR
IL-23 subunit alpha, Il23a, IL-23A, IL-23-A, IL23P19
| Formulation::PBS, Azide | Formulation::PBS, Azide1 |
| Applications:Flow Cytometry (FC) (INTRA) | Formulation::PBS, Azide2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide3 |
| Type:CatNo: Eg1634 Product name: Recombinant Mouse IL-23 p19/IL23A protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-196 aa of NM_031252.2 Sequence: VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA Predict reactive species | Formulation::PBS, Azide4 |
| RRID:83430 | Formulation::PBS, Azide5 |
| Storage Buffer:Q9EQ14 | Formulation::PBS, Azide6 |
| Background Information:IL-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918). | Formulation::PBS, Azide7 |
| biogegep8 | Formulation::PBS, Azide8 |
| biogegep9 | Formulation::PBS, Azide9 |
| Formulation::PBS, Azide0 | Applications:Flow Cytometry (FC) (INTRA)0 |