Anti-Mouse CD30 Ligand/TNFSF8 Rabbit Recombinant Antibody Proteintech 98113-1-RR
$299.00
In stock
SKU
98113-1-RR
Tnfsf8, 241012G10, CD30 ligand, CD30-L, Tumor necrosis factor ligand superfamily member 8
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0667 Product name: Recombinant Mouse CD30 Ligand/TNFSF8 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 68-239 aa of NM_009403.3 Sequence: QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：21949 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purfication | Formulation:：PBS, Azide6 |
| Background Information：CD30 Ligand (CD30L), also named as TNFSF8 or CD153, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) superfamily (PMID: 8391931). It is expressed on the surface of activated T cells, B cells, monocytes, macrophages, eosinophils, neutrophils, and mast cells (PMID: 26090498). CD30L interacts with its receptor, CD30, which is a cell surface protein expressed on a small subset of activated T and B lymphocytes, and a variety of lymphoid neoplasms, with the highest expression in classical Hodgkin lymphoma and anaplastic large cell lymphomas (PMID: 28885612). The CD30/CD30L signaling is involved in pleiotropic downstream effects including differentiation, cell survival and death, NFkB activation, and production of cytokines (PMID: 38534788). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
