Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody Proteintech 98263-1-RR
$299.00
In stock
SKU
98263-1-RR
TMIGD2/CD28, 241807A5, CD28 homolog, CD28H, IGPR1
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2264 Product name: Recombinant Human TMIGD2/CD28H protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-150 aa of BC015655 Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：126259 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q96BF3 | Formulation:：PBS, Azide6 |
| Background Information：Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2, also known as CD28H and IGPR1), plays a role in cell-cell interaction, migration, and angiogenesis. Through interaction with HHLA2, it costimulates T-cells in the context of TCR-mediated activation and enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade (PMID: 22419821; 23784006). TMIGD2 has been associated with several diseases, particularly in the context of cancer. It is aberrantly expressed by human AML cells and can be used to identify and enrich functional LSCs (PMID: 38167704). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
