Anti-Human BST2 Rabbit Recombinant Antibody Proteintech 98305-2-RR
$299.00
In stock
SKU
98305-2-RR
CD317, Bone marrow stromal antigen 2, BST 2, BST-2, CD 317
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1961 Product name: Recombinant Human BST2 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 49-161 aa of BC033873 Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：684 | Formulation:：PBS, Azide5 |
| Storage Buffer：Q10589 | Formulation:：PBS, Azide6 |
| Background Information：BST2, also named as CD317 and Tetherin, belongs to the tetherin family. It may be involved in the sorting of secreted proteins and it is involved in pre-B-cell growth. BST2 is an antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. BST2 may play a role in B-cell activation in rheumatoid arthritis. It is recently identified interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. BST2 is a plasma membrane proteins, tetherin inhibits virion particle release from infected cells. BST2 is effective against retroviruses and flavoviruses whilst IFITMs disrupt influenza and flavivirus infection. Observed MW of BST2 is 30-36 kDa (PMID: 19196977; 21237475). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
