SMUG1 Recombinant monoclonal antibody Proteintech 83771-5-RR
$299.00
In stock
SKU
83771-5-RR
UNG3, Single-strand selective monofunctional uracil DNA glycosylase, HMUDG, FDG, EC:3.2.2.-
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag13934 Product name: Recombinant human SMUG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC000417 Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQS Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SMUG1 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：UNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930).Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
