RPL29 Recombinant monoclonal antibody Proteintech 83377-1-RR
$299.00
In stock
SKU
83377-1-RR
240062F9, 60S ribosomal protein L29, Cell surface heparin-binding protein HIP, HIP, HUMRPL29
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34100 Product name: Recombinant human RPL29 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-97 aa of BC008926 Sequence: MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLA Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：RPL29 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Ribosomal protein L29 (Rpl29) is a component of the large (60S) ribosomal subunit which is abundantly expressed in all cell types, plays a regulatory role in translation efficiency and is essential for protein synthesis (PMID: 17195189). In contrast to adult tissues, RPL29 displays a much more widespread pattern of expression throughout embryonic development, and high levels of RPL29 are found in all developing organs. Several reports showed that RPL29 expression is up-regulated in human carcinomas and constitutes a candidate marker for abnormal growth when overexpressed(PMID: 9788632, 10383165). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
