C6orf130 Recombinant monoclonal antibody Proteintech 83500-4-RR
$299.00
In stock
SKU
83500-4-RR
OARD1, [Protein ADP-ribosylglutamate] hydrolase OARD1, 240455D7, ADP-ribose glycohydrolase OARD1, EC:3.2.2.-
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag19341 Product name: Recombinant human C6orf130 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC011709 Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：C6orf130 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：OARD1 (O-acetyl-ADP-ribose deacetylase 1), also known as TARG1?(Terminal ADP-ribose protein glycohydrolase 1) and C6orf130, is a ADP-ribose glycohydrolase that hydrolyzes ADP-ribose and acts on different substrates, such as proteins ADP-ribosylated on glutamate and O-acetyl-ADP-D-ribose (PMID: 21849506; 23474714; 23481255). The MW of this protein is 17 kDa, and this antibody specially recognises the 17 kDa protein. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
