KLF9 Recombinant monoclonal antibody Proteintech 83183-4-RR
$299.00
In stock
SKU
83183-4-RR
GC-box-binding protein 1, BTE-binding protein 1, BTEB1, BTEB, Basic transcription element-binding protein 1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34411 Product name: Recombinant human KLF9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC074880 Sequence: MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSAPSPLSLLHPGVAAKGKHASEKRHKCPYSGC Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：KLF9 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Krüppel-like factor 9 (KLF9) was a member of SP/KLF family of DNA-binding transcriptional regulators featured by a highly homologous C-terminal three C2H2-type zinc finger DNA-binding domains. KLF9 has been previously reported to be downregulated in various types of human malignancy and serves as a tumour suppressor at tumour onset and development, affecting cell proliferation, apoptosis, metastasis and tumorigenicity (PMID: 32855660). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
