Anti-Human DR4 Rabbit Recombinant Antibody Proteintech 98511-1-RR
$299.00
In stock
SKU
98511-1-RR
APO2, CD261, Death receptor 4, TNF-related apoptosis-inducing ligand receptor 1, TNFRSF10A
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg4600 Product name: Recombinant Human DR4 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 109-239 aa of BC012866 Sequence: ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：8797 | Formulation:：PBS, Azide5 |
| Storage Buffer：O00220 | Formulation:：PBS, Azide6 |
| Background Information：Tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) is a member of the TNF superfamily. TRAIL activates apoptosis through the death receptors DR4 (also known as TRAILR1 and TNFRSF10A) and DR5 (also known as TRAILR2, KILLER and TNFRSF10B). DR4 and DR5 are single-pass type I membrane proteins that contain intracellular death domains (DD) and upon activation mediate apoptotic signals (PMID: 11163110). Binding of TRAIL to DR4 or DR5 results in receptor oligomerization and recruitment of FAS-associated protein with death domain (FADD) and caspase 8 to form a functional death-inducing signalling complex (DISC). Upon DISC formation, caspase 8 is cleaved and activated, which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PMID: 18813321). DR4 or DR5 promotes the activation of NF-kappa-B and play an important role in inflammation (PMID: 9430227, 19434100). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
