CBX5 Recombinant monoclonal antibody Proteintech 83258-5-RR
$299.00
In stock
SKU
83258-5-RR
240145F11, Antigen p25, HP1, HP1 alpha, HP1A
| Formulation::PBS, Azide, Glycerol | Formulation::PBS, Azide, Glycerol1 |
| Applications:Western Blot (WB) | Formulation::PBS, Azide, Glycerol2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, Glycerol3 |
| Type:CatNo: Ag34810 Product name: Recombinant human CBX5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-120 aa of BC006821 Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG Predict reactive species | Formulation::PBS, Azide, Glycerol4 |
| RRID:CBX5 | Formulation::PBS, Azide, Glycerol5 |
| Storage Buffer:Liquid | Formulation::PBS, Azide, Glycerol6 |
| Background Information:Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443). | Formulation::PBS, Azide, Glycerol7 |
| biogegep8 | Formulation::PBS, Azide, Glycerol8 |
| biogegep9 | Formulation::PBS, Azide, Glycerol9 |
| Formulation::PBS, Azide, Glycerol0 | Applications:Western Blot (WB)0 |