Alpha-1-microglobulin Recombinant monoclonal antibody Proteintech 83678-3-RR
$299.00
In stock
SKU
83678-3-RR
AMBP, 240751G7, A1M, Alpha 1 microglobulin, Alpha 1 microglycoprotein
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Eg1127 Product name: Recombinant Human Alpha-1-microglobulin protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-203 aa of NM_001633.4 Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：Alpha 1 microglobulin | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
