TFF2 Recombinant monoclonal antibody Proteintech 83717-4-RR
$299.00
In stock
SKU
83717-4-RR
SML1, 240661G12, SP, Spasmolysin, Spasmolytic polypeptide
| Formulation::PBS, Azide, Glycerol | Formulation::PBS, Azide, Glycerol1 |
| Applications:Western Blot (WB) | Formulation::PBS, Azide, Glycerol2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, Glycerol3 |
| Type:CatNo: Ag4537 Product name: Recombinant human TFF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species | Formulation::PBS, Azide, Glycerol4 |
| RRID:TFF2 | Formulation::PBS, Azide, Glycerol5 |
| Storage Buffer:Liquid | Formulation::PBS, Azide, Glycerol6 |
| Background Information:The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671). | Formulation::PBS, Azide, Glycerol7 |
| biogegep8 | Formulation::PBS, Azide, Glycerol8 |
| biogegep9 | Formulation::PBS, Azide, Glycerol9 |
| Formulation::PBS, Azide, Glycerol0 | Applications:Western Blot (WB)0 |