KHSRP Recombinant monoclonal antibody Proteintech 82931-1-RR
$299.00
In stock
SKU
82931-1-RR
230189G1, Far upstream element-binding protein 2, FBP2, FUBP2, FUSE-binding protein 2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag33890 Product name: Recombinant human KHSRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 600-710 aa of NM_003685 Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：KHSRP | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possi3bly by recruiting degradation machinery to ARE-containing mRNAs. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
