GPX4 Monoclonal antibody proteintech 67763-1-Ig
$449.00
In stock
SKU
67763-1-Ig
3F5G5, EC:1.11.1.12, EC:1.11.1.9, GPx 4, GPx-4
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat, Pig, Rabbit, Canine, Chicken, Zebrafish, Hamster And More (4) | Immunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA | Observed Molecular Weight: 20-23 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: GPX4 |
| Conjugate: Unconjugated | Gene Symbol: 2879 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2909469 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Canine, Chicken, Zebrafish, Hamster | Form: Protein A purification |
| Host / Isotype: Mouse / IgG2b | Background Information: GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis. |
Reviews
Write Your Own Review