ALR Recombinant monoclonal antibody Proteintech 84972-4-RR

$299.00
In stock
SKU
84972-4-RR

 

GFER, 242557G3, EC:1.8.3.2, ERV1, FAD-linked sulfhydryl oxidase ALR

Formulation::PBS, Azide, Glycerol Formulation::PBS, Azide, Glycerol1
Applications:Western Blot (WB) Formulation::PBS, Azide, Glycerol2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide, Glycerol3
Type:CatNo: Ag1840 Product name: Recombinant human GFER protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC028348 Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD Predict reactive species Formulation::PBS, Azide, Glycerol4
RRID:GFER Formulation::PBS, Azide, Glycerol5
Storage Buffer:Protein A purification Formulation::PBS, Azide, Glycerol6
Background Information:GFER (FAD-linked sulfhydryl oxidase) is also named as ALR, HERV1, HPO. It plays an important role in the disulfide relay system (DRS) in human mitochondria. The GFER gene codes for 2 distinct isoforms that are probably synthesized from the same mRNA with the use of different initiation codons. The long isoform (205 amino acids, 23/21 kD) is located mainly in the mitochondrial intermembrane space and exists under nonreducing and nondenaturing conditions as a homodimer and a heterodimer. The shorter isoform (125 amino acids, 15 kD), which lacks 80 amino acids at its N terminus compared to the longer isoform, is present predominantly in the nucleus (PMID: 19409522, 24880092, 21152698). Formulation::PBS, Azide, Glycerol7
biogegep8 Formulation::PBS, Azide, Glycerol8
biogegep9 Formulation::PBS, Azide, Glycerol9
Formulation::PBS, Azide, Glycerol0 Applications:Western Blot (WB)0

 

 

Reviews

Write Your Own Review
You're reviewing:ALR Recombinant monoclonal antibody Proteintech 84972-4-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.