Cofilin Polyclonal antibody proteintech 10960-1-AP
$449.00
In stock
SKU
10960-1-AP
CFL1, 18 kDa phosphoprotein, Cofilin-1, Cofilin1, Cofilin, non-muscle isoform
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag1399 Product name: Recombinant human Cofilin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012318 |
| Conjugate: Unconjugated | Gene Symbol: Cofilin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1072 |
| Application: Western Blot (WB) | RRID: AB_2291830 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation.Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm. |
Reviews
Write Your Own Review