GM-CSF Polyclonal antibody proteintech 17762-1-AP
$449.00
In stock
SKU
17762-1-AP
CSF2, Colony stimulating factor, Colony Stimulating Factor 2, Colony-stimulating factor, CSF
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag12142 Product name: Recombinant human CSF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC108724 Sequence: MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 144 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC108724 |
| Conjugate: Unconjugated | Gene Symbol: GM-CSF |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1437 |
| Application: Western Blot (WB) | RRID: AB_2276718 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Granulocyte-macrophage colony-stimulating factor (GM-CSF), also known as colony-stimulating factor 2 (CSF2), is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, natural killer cells, endothelial cells and fibroblasts. GM-CSF is a hematopoietic growth factor that stimulates the development of early erythroid megakaryocytic and eosinophilic progenitor cells (PMID 2990035). GM-CSF stimulates stem cells to produce granulocytes (neutrophils, eosinophils, and basophils) and monocytes (PMID 3021817, 2984574, 6390681). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
