SRXN1 Polyclonal antibody proteintech 14273-1-AP

$449.00
In stock
SKU
14273-1-AP

 

C20orf139, EC:1.8.98.2, SRX, SRX1, Sulfiredoxin 1

Host / Isotype: Rabbit / IgG Class: Polyclonal
Reactivity: Human, Mouse And More (1) Immunogen: CatNo: Ag5613 Product name: Recombinant human SRX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC047707 Sequence: MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ Predict reactive species
 Applications: WB, IHC, IF, IP, ELISA Observed Molecular Weight: 14 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC047707
Conjugate: Unconjugated Gene Symbol: SRXN1
Tested Applications: Positive WB detected in Gene ID (NCBI): 140809
Application: Western Blot (WB) RRID: AB_2195030
Dilution: WB : 1:500-1:3000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse Form: Liquid
Host / Isotype: Rabbit / IgG

 

 

Reviews

Write Your Own Review
You're reviewing:SRXN1 Polyclonal antibody proteintech 14273-1-AP
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.