MMP12 Polyclonal antibody proteintech 22989-1-AP
$449.00
In stock
SKU
22989-1-AP
EC:3.4.24.65, HME, Macrophage elastase, Macrophage metalloelastase, Matrix metalloproteinase 12
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (2) | Immunogen: CatNo: Ag19068 Product name: Recombinant human MMP12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 231-402 aa of BC112301 Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 470 aa, 54 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC112301 |
| Conjugate: Unconjugated | Gene Symbol: MMP12 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4321 |
| Application: Western Blot (WB) | RRID: AB_2879193 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275). |