Claudin 5 Polyclonal antibody proteintech 29767-1-AP
$449.00
In stock
SKU
29767-1-AP
CLDN5, AWAL, BEC1, Claudin5, Claudin-5
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag29044 Product name: Recombinant human CLDN5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 144-218 aa of BC032363 Sequence: VREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 218 aa, 23 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032363 |
| Conjugate: Unconjugated | Gene Symbol: CLDN5 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7122 |
| Application: Western Blot (WB) | RRID: AB_2935477 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. |
Reviews
Write Your Own Review