C9orf72 Polyclonal antibody proteintech 22637-1-AP
$449.00
In stock
SKU
22637-1-AP
C9RANT, DENND9, DENNL72, Guanine nucleotide exchange factor C9orf72
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag18326 Product name: Recombinant human C9orf72 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 481 aa, 54 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020851 |
| Conjugate: Unconjugated | Gene Symbol: C9orf72 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 203228 |
| Application: Western Blot (WB) | RRID: AB_10953528 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. It has been reported that C9orf72 forms a complex with Cofilin and other actin binding proteins and 22637-1-AP antibody detects the complex bands around 43 and 68-72 kDa in SDS-PAGE.(PMID: 27723745) |
Reviews
Write Your Own Review