IL-17a Polyclonal antibody proteintech 26163-1-AP
$449.00
In stock
SKU
26163-1-AP
Il17a, IL 17A, Il17, IL-17, interleukin 17A
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag24087 Product name: Recombinant mouse IL-17A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM-010552 |
| Conjugate: Unconjugated | Gene Symbol: Il17a |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 16171 |
| Application: Western Blot (WB) | RRID: AB_2880409 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The IL17A monomer is a peptide consisting of 155 amino acids. The IL17A peptide comprises a 23 amino acid signal peptide and a 132 amino acid mature peptide. The IL17A homodimer has a molecular weight of 35 kD (Kolls and Lindén, 2004). |
Reviews
Write Your Own Review